PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00045g00221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 393aa    MW: 44574.4 Da    PI: 7.9916
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00045g00221.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32207260255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Peaxi162Scf00045g00221.1 207 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 260
                               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15204260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28205260IPR009057Homeodomain-like
TIGRFAMsTIGR015579.4E-24207260IPR006447Myb domain, plants
PfamPF002496.9E-7208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNNK QSWKGSASAT VEEEHMDLGF WKRALESRNT NNNTTTSTTS  60
CFELSLSNNN VPRPSSTTHQ EPNSKFIHSS LHQNHFINNY QQQQQQLLQN QVLSPHHELG  120
FLRPIRGVPL YNQNPPAPTL SPFPFSHQQT FDTTTSLPSF NSNNNNMMMS SSNSHFQSHH  180
HHHHHQGGVM RSRFMSRFPV KRSMRAPRMR WTSTLHARFV HAVELLGGHE RATPKSVLEL  240
MDVKDLTLAH VKSHLQMYRT VKTTDKSAAG AASSGQSEVY DNGSSGDNSE ELVLEIQNSR  300
KSELSVQQGR ENMHHQEKDY RGLWSNSSSR ESWQLHGKLR EDYPENIPSL EKELEAKCLS  360
YEGISTEVSS SSITEASPKK KPNLEFTLGR TLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109391e-39AP010939.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0175O15, complete sequence.
GenBankHG9754471e-39HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755201e-39HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361268.11e-168PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6162e-91KAN2_ARATH; Probable transcription factor KAN2
TrEMBLM1BKY11e-168M1BKY1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000475321e-168(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-47G2-like family protein